"BTBD10" Related Products

Expand

Recombinant Human BTBD10, His-tagged

Cat.No.: BTBD10-26109TH
Product Overview: Recombinant fragment, corresponding to amino acids 143-475 of Human BTBD10 with an N terminal His tag. Observed mwt: 53 kDa; predicted mwt: 38 kDa;
Description: BTBD10 appears to behave as a suppressor of cell death, which includes neuronal cell death related to amyotrophic lateral sclerosis.It may also act as an enhancer of cell growth via its positive regulation of Akt phosphorylation.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 154 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CKTAGEMVFVYENAKEGARNIRTSERVTLIVDNTRFVVDP SIFTAQPNTMLGRMFGSGREHNFTRPNEKGEYEVAEGI GSTVFRAILDYYKTGIIRCPDGISIPELREACDYLCIS FEYSTIKCRDLSALMHELSNDGARRQFEFYLEEMILPLMVASAQSGERECHIVVLTDDDVVDWDEEYPPQMGEEYSQI IYSTKLYRFFKYIENRDVAKSVLKERGLKKIRLGIEGY PTYKEKVKKRPGGRPEVIYNYVQRPFIRMSWEKEEGKS RHVDFQCVKSKSITNLAAAAADIPQDQLVVMHPTPQVD ELDILPIHPPSGNSDLDPDAQNPML
Gene Name: BTBD10 BTB (POZ) domain containing 10 [ Homo sapiens ]
Official Symbol: BTBD10
Synonyms: BTBD10; BTB (POZ) domain containing 10; BTB/POZ domain-containing protein 10; GMRP 1; GMRP1; MGC13007;
Gene ID: 84280
mRNA Refseq: NM_032320
Protein Refseq: NP_115696
Uniprot ID: Q9BSF8
Chromosome Location: 11p15.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.