"C14ORF166" Related Products

Recombinant Human C14ORF166, His-tagged

Cat.No.: C14ORF166-26586TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-244 of Human C14orf166 with N terminal His tag, 31kDa.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed. Expressed at high level in heart and skeletal muscle. Expressed at intermediate level in liver, pancreas, fetal brain and fetal lung. Weakly expressed in adult brain, adult lung, placenta, fetal liver and fetal kidney. Overexpressed in m
Form: Lyophilised:Reconstitute with 105 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHY KIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQE AIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKN AEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAI RILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGD AVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIAD PKTDHRLGKVGR
Sequence Similarities: Belongs to the UPF0568 family.
Gene Name: C14orf166 chromosome 14 open reading frame 166 [ Homo sapiens ]
Official Symbol: C14ORF166
Synonyms: C14ORF166; chromosome 14 open reading frame 166; UPF0568 protein C14orf166; CGI 99; RLL motif containing 1; RLLM1;
Gene ID: 51637
mRNA Refseq: NM_016039
Protein Refseq: NP_057123
MIM: 610858
Uniprot ID: Q9Y224
Chromosome Location: 14q22.1
Function: identical protein binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.