"C1QTNF9" Related Products

Expand

Recombinant Human C1QTNF9, His-tagged

Cat.No.: C1QTNF9-26127TH
Product Overview: Recombinant fragment from the globular domain of Human C1QTNF9 corresponding to amino acids 195-333 (139 aas) with a N terminal His-tag; predicted MWt: 16 kDa.
Description: Adiponectin is a major insulin-sensitizing, multimeric hormone derived from adipose tissue that acts on muscle and liver to regulate whole-body glucose and lipid metabolism.
Protein length: 139 amino acids
Conjugation: HIS
Molecular Weight: 16.000kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed predominantly in adipose tissue.
Form: Lyophilised:Reconstitute in an appropriate buffer.
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: PBS, 55mM Tris HCl, 150mM Sodium chloride, 1mM DTT, pH 8.2
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: ETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP
Sequence Similarities: Contains 1 C1q domain.Contains 3 collagen-like domains.
Gene Name: C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ]
Official Symbol: C1QTNF9
Synonyms: C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915;
Gene ID: 338872
mRNA Refseq: NM_178540
Protein Refseq: NP_848635
MIM: 614285
Uniprot ID: P0C862
Chromosome Location: 13q12.12
Function: hormone activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.