Recombinant Human CAPZA1
| Cat.No. : | CAPZA1-26237TH |
| Product Overview : | Recombinant fragment of Human CAPZA1 with an N terminal proprietary tag; Predicted MWt 35.42 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 89 amino acids |
| Description : | CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein.The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. |
| Molecular Weight : | 35.420kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWN |
| Sequence Similarities : | Belongs to the F-actin-capping protein alpha subunit family. |
| Gene Name | CAPZA1 capping protein (actin filament) muscle Z-line, alpha 1 [ Homo sapiens ] |
| Official Symbol | CAPZA1 |
| Synonyms | CAPZA1; capping protein (actin filament) muscle Z-line, alpha 1; F-actin-capping protein subunit alpha-1; |
| Gene ID | 829 |
| mRNA Refseq | NM_006135 |
| Protein Refseq | NP_006126 |
| MIM | 601580 |
| Uniprot ID | P52907 |
| Chromosome Location | 1p13.2 |
| Pathway | Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; |
| Function | actin binding; |
| ◆ Recombinant Proteins | ||
| CAPZA1&CAPZB-869H | Active Recombinant Human CAPZA1/CAPZB Protein, His-tagged | +Inquiry |
| CAPZA1-2707M | Recombinant Mouse CAPZA1 Protein | +Inquiry |
| CAPZA1-1128R | Recombinant Rat CAPZA1 Protein | +Inquiry |
| CAPZA1-26237TH | Recombinant Human CAPZA1 | +Inquiry |
| CAPZA1-0841H | Recombinant Human CAPZA1 Protein (Met1-Ala286), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAPZA1-7853HCL | Recombinant Human CAPZA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAPZA1 Products
Required fields are marked with *
My Review for All CAPZA1 Products
Required fields are marked with *



