Recombinant Human CAV1 protein, GST-tagged

Cat.No. : CAV1-26608TH
Product Overview : Recombinant Human CAV1(1 a.a. - 178 a.a) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-178 a.a.
Description : The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 45.21 kDa
AA Sequence : MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEP EGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI YVHTVCDPLFEAVGKIFSNVRINLQKEI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CAV1 caveolin 1, caveolae protein, 22kDa [ Homo sapiens ]
Official Symbol CAV1
Synonyms CAV1; caveolin 1, caveolae protein, 22kDa; CAV, caveolin 1, caveolae protein, 22kD; caveolin-1; cell growth-inhibiting protein 32; CGL3; BSCL3; VIP21; MSTP085;
Gene ID 857
mRNA Refseq NM_001172895
Protein Refseq NP_001166366
MIM 601047
UniProt ID Q03135
Chromosome Location 7q31
Pathway ALK1 signaling events, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Basigin interactions, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem;
Function cholesterol binding; kinase binding; nitric-oxide synthase binding; patched binding; peptidase activator activity; protein binding; protein complex scaffold; receptor binding; structural molecule activity; syntaxin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAV1 Products

Required fields are marked with *

My Review for All CAV1 Products

Required fields are marked with *

0
cart-icon
0
compare icon