Recombinant Rat Cav1 protein, His&Myc-tagged
| Cat.No. : | Cav1-2640R |
| Product Overview : | Recombinant Rat Cav1 protein(P41350)(2-178aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-178aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.9 kDa |
| AA Sequence : | SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Cav1 caveolin 1, caveolae protein [ Rattus norvegicus ] |
| Official Symbol | Cav1 |
| Synonyms | CAV1; caveolin 1, caveolae protein; caveolin-1; caveolin, caveolae protein 1; caveolin caveolae protein 22 kDa; Cav; MGC187299; |
| Gene ID | 25404 |
| mRNA Refseq | NM_031556 |
| Protein Refseq | NP_113744 |
| ◆ Recombinant Proteins | ||
| CAV1-2964Z | Recombinant Zebrafish CAV1 | +Inquiry |
| CAV1-3752C | Recombinant Chicken CAV1 | +Inquiry |
| Cav1-2640R | Recombinant Rat Cav1 protein, His&Myc-tagged | +Inquiry |
| CAV1-1258M | Recombinant Mouse CAV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CAV1-2773M | Recombinant Mouse CAV1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAV1-7822HCL | Recombinant Human CAV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cav1 Products
Required fields are marked with *
My Review for All Cav1 Products
Required fields are marked with *



