Recombinant Human CAV2

Cat.No. : CAV2-26609TH
Product Overview : Recombinant full length Human Caveolin 2 (amino acids 1-162) with a N terminal proprietary tag: predicted molecular weight 43.89 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 162 amino acids
Description : The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462).
Molecular Weight : 43.890kDa inclusive of tags
Tissue specificity : Expressed in endothelial cells, smooth muscle cells, skeletal myoblasts and fibroblasts.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDR DPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEIS KYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLS QD
Sequence Similarities : Belongs to the caveolin family.
Gene Name CAV2 caveolin 2 [ Homo sapiens ]
Official Symbol CAV2
Synonyms CAV2; caveolin 2; caveolin-2; CAV;
Gene ID 858
mRNA Refseq NM_001206747
Protein Refseq NP_001193676
MIM 601048
Uniprot ID P51636
Chromosome Location 7q31
Pathway Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function D1 dopamine receptor binding; phosphoprotein binding; protein binding; protein homodimerization activity; syntaxin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAV2 Products

Required fields are marked with *

My Review for All CAV2 Products

Required fields are marked with *

0
cart-icon
0
compare icon