"CD3E" Related Products

Expand
Expand

Recombinant Human CD3E

Cat.No.: CD3E-26926TH
Product Overview: Recombinant full length mature Human CD3 epsilon with N terminal proprietary tag; predicted MWt 46.46 kDa inclusive of tag
Description: The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Protein length: 185 amino acids
Molecular Weight: 46.460kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRN DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRG SKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITG GLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPP VPNPDYEPIRKGQRDLYSGLNQRRI
Sequence Similarities: Contains 1 Ig-like (immunoglobulin-like) domain.Contains 1 ITAM domain.
Gene Name: CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ]
Official Symbol: CD3E
Synonyms: CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain;
Gene ID: 916
mRNA Refseq: NM_000733
Protein Refseq: NP_000724
Uniprot ID: P07766
Chromosome Location: 11q23
Pathway: Adaptive Immune System, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem;
Function: SH3 domain binding; T cell receptor binding; protein heterodimerization activity; protein kinase binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.