"CDC26" Related Products

Expand
Expand

Recombinant Human CDC26, His-tagged

Cat.No.: CDC26-27901TH
Product Overview: Recombinant full length Human Cdc26 / Apc12 with an N terminal His tag; 105 amino acids with tag, MWt 11.9 kDa.
Description: The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins.
Protein length: 85 amino acids
Conjugation: HIS
Molecular Weight: 11.900kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF
Gene Name: CDC26 cell division cycle 26 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol: CDC26
Synonyms: CDC26; cell division cycle 26 homolog (S. cerevisiae); C9orf17, cell division cycle 26 , chromosome 9 open reading frame 17; anaphase-promoting complex subunit CDC26; ANAPC12; anaphase promoting complex subunit 12; APC12; CDC26 subunit of anaphase promo
Gene ID: 246184
mRNA Refseq: NM_139286
Protein Refseq: NP_644815
Uniprot ID: Q8NHZ8
Chromosome Location: 9q32
Pathway: APC/C complex, organism-specific biosystem; APC/C complex, conserved biosystem; APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Cyclin B, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.