Recombinant Human CDK16, His-tagged CDK16-29485TH

Recombinant Human CDK16, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CDK16, His-tagged

Recombinant Human CDK16, His-tagged

CDK16 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CDK16-29485TH
Product Overview : Recombinant fragment, corresponding to amino acids 338-496 of Human PCTAIRE1 with N terminal His tag; 159 amino acids, 20kDa.
Description : The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells; in exocytosis; and in transport of secretory cargo from the endoplasmic reticulum. This gene is thought to escape X inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 114 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRI LGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRL DSDGADLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFRVVD TEF
Sequence Similarities : Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.Contains 1 protein kinase domain.
Gene Name : CDK16 cyclin-dependent kinase 16 [ Homo sapiens ]
Official Symbol : CDK16
Synonyms : CDK16; cyclin-dependent kinase 16; PCTAIRE protein kinase 1 , PCTK1; FLJ16665; PCTAIRE; PCTAIRE1; PCTGAIRE; serine/threonine protein kinase;
Gene ID : 5127
mRNA Refseq : NM_001170460
Protein Refseq : NP_001163931
MIM : 311550
Uniprot ID : Q00536
Chromosome Location : Xp11
Function : ATP binding; cyclin-dependent protein kinase activity; nucleotide binding; protein binding; protein kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy