"CDK16" Related Products

Expand

Recombinant Human CDK16, His-tagged

Cat.No.: CDK16-29485TH
Product Overview: Recombinant fragment, corresponding to amino acids 338-496 of Human PCTAIRE1 with N terminal His tag; 159 amino acids, 20kDa.
Description: The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells; in exocytosis; and in transport of secretory cargo from the endoplasmic reticulum. This gene is thought to escape X inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 114 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRI LGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRL DSDGADLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFRVVD TEF
Sequence Similarities: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.Contains 1 protein kinase domain.
Gene Name: CDK16 cyclin-dependent kinase 16 [ Homo sapiens ]
Official Symbol: CDK16
Synonyms: CDK16; cyclin-dependent kinase 16; PCTAIRE protein kinase 1 , PCTK1; FLJ16665; PCTAIRE; PCTAIRE1; PCTGAIRE; serine/threonine protein kinase;
Gene ID: 5127
mRNA Refseq: NM_001170460
Protein Refseq: NP_001163931
MIM: 311550
Uniprot ID: Q00536
Chromosome Location: Xp11
Function: ATP binding; cyclin-dependent protein kinase activity; nucleotide binding; protein binding; protein kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.