"CDT1" Related Products

Expand
Expand

Recombinant Human CDT1, His-tagged

Cat.No.: CDT1-27915TH
Product Overview: Recombinant fragment, corresponding to amino acids 416-546 of Human CDT1 with N terminal His tag; Predicted MWt 16 kDa.
Description: The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at inappropriate origins. Phosphorylation of this protein by cyclin A-dependent kinases results in degradation of the protein.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 92 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLP ELARVLRSVFVSERKPALSMEVACARMVGSCCTIMSPG EMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAH ITARLAHQTRAEEGL
Sequence Similarities: Belongs to the Cdt1 family.
Gene Name: CDT1 chromatin licensing and DNA replication factor 1 [ Homo sapiens ]
Official Symbol: CDT1
Synonyms: CDT1; chromatin licensing and DNA replication factor 1; DNA replication factor Cdt1; DUP; RIS2;
Gene ID: 81620
mRNA Refseq: NM_030928
Protein Refseq: NP_112190
MIM: 605525
Uniprot ID: Q9H211
Chromosome Location: 16q24.3
Pathway: Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; CDT1 association with the CDC6:ORC:origin complex, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function: DNA binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.