Recombinant Human CDT1, His-tagged
Cat.No. : | CDT1-27915TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 416-546 of Human CDT1 with N terminal His tag; Predicted MWt 16 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 416-546 a.a. |
Description : | The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at inappropriate origins. Phosphorylation of this protein by cyclin A-dependent kinases results in degradation of the protein. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 92 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLP ELARVLRSVFVSERKPALSMEVACARMVGSCCTIMSPG EMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAH ITARLAHQTRAEEGL |
Sequence Similarities : | Belongs to the Cdt1 family. |
Gene Name | CDT1 chromatin licensing and DNA replication factor 1 [ Homo sapiens ] |
Official Symbol | CDT1 |
Synonyms | CDT1; chromatin licensing and DNA replication factor 1; DNA replication factor Cdt1; DUP; RIS2; |
Gene ID | 81620 |
mRNA Refseq | NM_030928 |
Protein Refseq | NP_112190 |
MIM | 605525 |
Uniprot ID | Q9H211 |
Chromosome Location | 16q24.3 |
Pathway | Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; CDT1 association with the CDC6:ORC:origin complex, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
Function | DNA binding; protein binding; |
◆ Recombinant Proteins | ||
CDT1-11073H | Recombinant Human CDT1, GST-tagged | +Inquiry |
CDT1-3240M | Recombinant Mouse CDT1 Protein | +Inquiry |
CDT1-1550M | Recombinant Mouse CDT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDT1-9663HFL | Recombinant Full Length Human CDT1 protein, Flag-tagged | +Inquiry |
CDT1-105H | Recombinant Human CDT1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDT1-7604HCL | Recombinant Human CDT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDT1 Products
Required fields are marked with *
My Review for All CDT1 Products
Required fields are marked with *