"CEP70" Related Products

Expand

Recombinant Human CEP70, His-tagged

Cat.No.: CEP70-27167TH
Product Overview: Recombinant fragment, corresponding to amino acids 269-597 of Human CEP70 with N terminal His tag; Predicted MWt 39kDa.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 151 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SKSKIDALSSEKLNLQKDLETRPTQHELRLYKQQVKKLEK ALKKNVKLQELINHKKAEDTEKKDEPSKYNQQQALIDQ RYFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLV QDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAELVP WLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPH FQTLQAIVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMN NAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNE QVMQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEI LEIDDLDAIVPAVKKLKVLSY
Sequence Similarities: Contains 1 TPR repeat.
Gene Name: CEP70 centrosomal protein 70kDa [ Homo sapiens ]
Official Symbol: CEP70
Synonyms: CEP70; centrosomal protein 70kDa; centrosomal protein of 70 kDa; BITE; FLJ13036;
Gene ID: 80321
mRNA Refseq: NM_024491
Protein Refseq: NP_077817
MIM: 614310
Uniprot ID: Q8NHQ1
Chromosome Location: 3q22.3
Pathway: Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.