Recombinant Human CETN1

• Cat.No.: CETN1-27954TH
• Product Overview: Recombinant fragment of Human Centrin 1 with N terminal proprietary tag, 34.32kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 79 amino acids
• Description: The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.
• Molecular Weight: 34.320kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVM
• Sequence Similarities: Belongs to the centrin family.Contains 4 EF-hand domains.

Gene Information

• Gene Name: CETN1 centrin, EF-hand protein, 1 [ Homo sapiens ]
• Official Symbol: CETN1
• Synonyms: CETN1; centrin, EF-hand protein, 1; CETN; centrin-1; CEN1
• Gene ID: 1068
• mRNA Refseq: NM_004066
• Protein Refseq: NP_004057
• MIM: 603187
• Uniprot ID: Q12798
• Chromosome Location: 18p11.32
• Function: ATP binding; ATP-dependent helicase activity; G-protein beta/gamma-subunit complex binding; calcium ion binding; nucleic acid binding

Citation

Evaluation of novel highly specific antibodies to cancer testis antigen Centrin‐1 for radioimmunoimaging and radioimmunotherapy of pancreatic cancer

Journal: Cancer Medicine    PubMed ID: 31309741    Data: 2019/7/16

Authors: Rubin Jiao, Kevin J. H. Allen, Ekaterina Dadachova

Article Snippet:The binding of 69‐11 antibody to human versus murine CETN1 was evaluated.The binding of 69‐11 antibody to human versus murine CETN1 was evaluated.. For this human CETN1 (hRP‐T0488‐EF042 lot 11912K11) was purchased from GeneCopoeia; and the murine CETN1 (854M lot: 218873)—from Creative BioMart.. The comparative ELISA was performed using the conditions described above in Screening of hybridomas.The comparative ELISA was performed using the conditions described above in Screening of hybridomas.

Comparative sequences of human and mouse CETN1 and CETN2

Representative immunohistochemistry images of PDAC tumors and normal pancreas from tumor microarrays stained with immune serum from CETN1‐immunized mice. A and B, Tumors showing positive CETN1 staining; C and D, tumors showing negative CETN1 staining; E and F, normal pancreas showing negative CETN1 staining

Binding of IgM antibodies to CETN1 and CETN2