Recombinant Full Length Human CETN1 Protein, GST-tagged
Cat.No. : | CETN1-3287HF |
Product Overview : | Human CETN1 full-length ORF (NP_004057.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 172 amino acids |
Description : | The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq, Jan 2015] |
Molecular Mass : | 46 kDa |
AA Sequence : | MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CETN1 centrin, EF-hand protein, 1 [ Homo sapiens ] |
Official Symbol | CETN1 |
Synonyms | CETN1; centrin, EF-hand protein, 1; CETN; centrin-1; CEN1; caltractin; EF-hand protein; calcium binding protein; |
Gene ID | 1068 |
mRNA Refseq | NM_004066 |
Protein Refseq | NP_004057 |
MIM | 603187 |
UniProt ID | Q12798 |
◆ Recombinant Proteins | ||
CETN1-6776H | Recombinant Human Centrin, EF-hand Protein, 1, His-tagged | +Inquiry |
CETN1-3854M | Recombinant Mouse CETN1 Protein, His-tagged | +Inquiry |
CETN1-3321H | Recombinant Human CETN1 protein | +Inquiry |
CETN1-1606M | Recombinant Mouse CETN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CETN1-11128H | Recombinant Human CETN1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CETN1-7562HCL | Recombinant Human CETN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CETN1 Products
Required fields are marked with *
My Review for All CETN1 Products
Required fields are marked with *
0
Inquiry Basket