Recombinant Human CETN1
| Cat.No. : | CETN1-27955TH |
| Product Overview : | Recombinant fragment of Human Centrin 1 with N terminal proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEK |
| Sequence Similarities : | Belongs to the centrin family.Contains 4 EF-hand domains. |
| Gene Name | CETN1 centrin, EF-hand protein, 1 [ Homo sapiens ] |
| Official Symbol | CETN1 |
| Synonyms | CETN1; centrin, EF-hand protein, 1; CETN; centrin-1; CEN1; |
| Gene ID | 1068 |
| mRNA Refseq | NM_004066 |
| Protein Refseq | NP_004057 |
| MIM | 603187 |
| Uniprot ID | Q12798 |
| Chromosome Location | 18p11.32 |
| Function | ATP binding; ATP-dependent helicase activity; G-protein beta/gamma-subunit complex binding; calcium ion binding; nucleic acid binding; |
| ◆ Recombinant Proteins | ||
| Cetn1-2126M | Recombinant Mouse Cetn1 Protein, Myc/DDK-tagged | +Inquiry |
| CETN1-3854M | Recombinant Mouse CETN1 Protein, His-tagged | +Inquiry |
| CETN1-27954TH | Recombinant Human CETN1 | +Inquiry |
| CETN1-5252C | Recombinant Chicken CETN1 | +Inquiry |
| CETN1-1606M | Recombinant Mouse CETN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CETN1-7562HCL | Recombinant Human CETN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CETN1 Products
Required fields are marked with *
My Review for All CETN1 Products
Required fields are marked with *




