Recombinant Human CETN1

Cat.No. : CETN1-27955TH
Product Overview : Recombinant fragment of Human Centrin 1 with N terminal proprietary tag, 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEK
Sequence Similarities : Belongs to the centrin family.Contains 4 EF-hand domains.
Gene Name CETN1 centrin, EF-hand protein, 1 [ Homo sapiens ]
Official Symbol CETN1
Synonyms CETN1; centrin, EF-hand protein, 1; CETN; centrin-1; CEN1;
Gene ID 1068
mRNA Refseq NM_004066
Protein Refseq NP_004057
MIM 603187
Uniprot ID Q12798
Chromosome Location 18p11.32
Function ATP binding; ATP-dependent helicase activity; G-protein beta/gamma-subunit complex binding; calcium ion binding; nucleic acid binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CETN1 Products

Required fields are marked with *

My Review for All CETN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon