Recombinant Human CETN1

Cat.No. : CETN1-27954TH
Product Overview : Recombinant fragment of Human Centrin 1 with N terminal proprietary tag, 34.32kDa.
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 79 amino acids
Description : The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.
Molecular Weight : 34.320kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVM
Sequence Similarities : Belongs to the centrin family.Contains 4 EF-hand domains.
Gene Name CETN1 centrin, EF-hand protein, 1 [ Homo sapiens ]
Official Symbol CETN1
Synonyms CETN1; centrin, EF-hand protein, 1; CETN; centrin-1; CEN1;
Gene ID 1068
mRNA Refseq NM_004066
Protein Refseq NP_004057
MIM 603187
Uniprot ID Q12798
Chromosome Location 18p11.32
Function ATP binding; ATP-dependent helicase activity; G-protein beta/gamma-subunit complex binding; calcium ion binding; nucleic acid binding;

Evaluation of novel highly specific antibodies to cancer testis antigen Centrin‐1 for radioimmunoimaging and radioimmunotherapy of pancreatic cancer

Journal: Cancer Medicine    PubMed ID: 31309741    Data: 2019/7/16

Authors: Rubin Jiao, Kevin J. H. Allen, Ekaterina Dadachova

Article Snippet:The binding of 69‐11 antibody to human versus murine CETN1 was evaluated.The binding of 69‐11 antibody to human versus murine CETN1 was evaluated.. For this human CETN1 (hRP‐T0488‐EF042 lot 11912K11) was purchased from GeneCopoeia; and the murine CETN1 (854M lot: 218873)—from Creative BioMart.. The comparative ELISA was performed using the conditions described above in Screening of hybridomas.The comparative ELISA was performed using the conditions described above in Screening of hybridomas.

Comparative sequences of human and mouse CETN1 and CETN2

Comparative sequences of human and mouse CETN1 and CETN2

Representative immunohistochemistry images of PDAC tumors and normal pancreas from tumor microarrays stained with immune serum from CETN1‐immunized mice. A and B, Tumors showing positive CETN1 staining; C and D, tumors showing negative CETN1 staining; E and F, normal pancreas showing negative CETN1 staining

Representative immunohistochemistry images of PDAC tumors and normal pancreas from tumor microarrays stained with immune serum from CETN1‐immunized mice. A and B, Tumors showing positive CETN1 staining; C and D, tumors showing negative CETN1 staining; E and F, normal pancreas showing negative CETN1 staining

Binding of IgM antibodies to  CETN1  and CETN2

Binding of IgM antibodies to CETN1 and CETN2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CETN1 Products

Required fields are marked with *

My Review for All CETN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon