"CHKB" Related Products

Expand
Expand

Recombinant Human CHKB

Cat.No.: CHKB-26715TH
Product Overview: Recombinant full length Human CHKL with a N terminal proprietary tag; Predicted MWt 69.52 kDa.
Description: Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus.
Protein length: 395 amino acids
Molecular Weight: 69.520kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASS LSRDAERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSN LLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELRE PVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQ DLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNH FCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEA KKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQ ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
Sequence Similarities: Belongs to the choline/ethanolamine kinase family.
Gene Name: CHKB choline kinase beta [ Homo sapiens ]
Official Symbol: CHKB
Synonyms: CHKB; choline kinase beta; CHKL, choline kinase like; choline/ethanolamine kinase; CHETK;
Gene ID: 1120
mRNA Refseq: NM_005198
Protein Refseq: NP_005189
MIM: 612395
Uniprot ID: Q9Y259
Chromosome Location: 22q13.33
Pathway: AMPK signaling, organism-specific biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: ATP binding; choline kinase activity; ethanolamine kinase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.