Recombinant Human CHKB
Cat.No. : | CHKB-26715TH |
Product Overview : | Recombinant full length Human CHKL with a N terminal proprietary tag; Predicted MWt 69.52 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. |
Protein length : | 395 amino acids |
Molecular Weight : | 69.520kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASS LSRDAERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSN LLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELRE PVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQ DLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNH FCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEA KKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQ ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS |
Sequence Similarities : | Belongs to the choline/ethanolamine kinase family. |
Gene Name : | CHKB choline kinase beta [ Homo sapiens ] |
Official Symbol : | CHKB |
Synonyms : | CHKB; choline kinase beta; CHKL, choline kinase like; choline/ethanolamine kinase; CHETK; |
Gene ID : | 1120 |
mRNA Refseq : | NM_005198 |
Protein Refseq : | NP_005189 |
MIM : | 612395 |
Uniprot ID : | Q9Y259 |
Chromosome Location : | 22q13.33 |
Pathway : | AMPK signaling, organism-specific biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function : | ATP binding; choline kinase activity; ethanolamine kinase activity; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
Chkb-885M | Recombinant Mouse Chkb Protein, MYC/DDK-tagged | +Inquiry |
CHKB-1032R | Recombinant Rat CHKB Protein, His (Fc)-Avi-tagged | +Inquiry |
CHKB-1645M | Recombinant Mouse CHKB Protein, His (Fc)-Avi-tagged | +Inquiry |
CHKB-775H | Recombinant Human CHKB Protein, His-tagged | +Inquiry |
CHKB-1243H | Recombinant Human CHKB Protein, GST-Tagged | +Inquiry |
◆ Lysates | ||
CHKB-7534HCL | Recombinant Human CHKB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket