Recombinant Human CHRND

• Cat.No.: CHRND-26906TH
• Product Overview: Recombinant fragment of Human CHRND with N terminal proprietary tag; Predicted MW 37.40 kDa.

Specification

• Description: The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits.After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
• Protein length: 107 amino acids
• Molecular Weight: 37.400kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNL ISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRL PPDMVWLPEIVLENNNDGSFQISYSCN
• Sequence Similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Delta/CHRND sub-subfamily.

Gene Information

• Gene Name: CHRND cholinergic receptor, nicotinic, delta [ Homo sapiens ]
• Official Symbol: CHRND
• Synonyms: CHRND; cholinergic receptor, nicotinic, delta; ACHRD, cholinergic receptor, nicotinic, delta polypeptide; acetylcholine receptor subunit delta
• Gene ID: 1144
• mRNA Refseq: NM_000751
• Protein Refseq: NP_000742
• MIM: 100720
• Uniprot ID: Q07001
• Chromosome Location: 2q33-qter
• Pathway: Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Highly sodium permeable acetylcholine nicotinic receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem
• Function: acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity