"CHRND" Related Products

Expand
Expand

Recombinant Human CHRND

Cat.No.: CHRND-26906TH
Product Overview: Recombinant fragment of Human CHRND with N terminal proprietary tag; Predicted MW 37.40 kDa.
Description: The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits.After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Protein length: 107 amino acids
Molecular Weight: 37.400kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNL ISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRL PPDMVWLPEIVLENNNDGSFQISYSCN
Sequence Similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Delta/CHRND sub-subfamily.
Gene Name: CHRND cholinergic receptor, nicotinic, delta [ Homo sapiens ]
Official Symbol: CHRND
Synonyms: CHRND; cholinergic receptor, nicotinic, delta; ACHRD, cholinergic receptor, nicotinic, delta polypeptide; acetylcholine receptor subunit delta;
Gene ID: 1144
mRNA Refseq: NM_000751
Protein Refseq: NP_000742
MIM: 100720
Uniprot ID: Q07001
Chromosome Location: 2q33-qter
Pathway: Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Highly sodium permeable acetylcholine nicotinic receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem;
Function: acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.