Recombinant Human CHRND

Cat.No. : CHRND-26906TH
Product Overview : Recombinant fragment of Human CHRND with N terminal proprietary tag; Predicted MW 37.40 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 107 amino acids
Description : The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits.After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Molecular Weight : 37.400kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNL ISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRL PPDMVWLPEIVLENNNDGSFQISYSCN
Sequence Similarities : Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Delta/CHRND sub-subfamily.
Gene Name CHRND cholinergic receptor, nicotinic, delta [ Homo sapiens ]
Official Symbol CHRND
Synonyms CHRND; cholinergic receptor, nicotinic, delta; ACHRD, cholinergic receptor, nicotinic, delta polypeptide; acetylcholine receptor subunit delta;
Gene ID 1144
mRNA Refseq NM_000751
Protein Refseq NP_000742
MIM 100720
Uniprot ID Q07001
Chromosome Location 2q33-qter
Pathway Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Highly sodium permeable acetylcholine nicotinic receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem;
Function acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRND Products

Required fields are marked with *

My Review for All CHRND Products

Required fields are marked with *

0
cart-icon
0
compare icon