Recombinant Human CHRND
Cat.No. : | CHRND-26906TH |
Product Overview : | Recombinant fragment of Human CHRND with N terminal proprietary tag; Predicted MW 37.40 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 107 amino acids |
Description : | The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits.After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. |
Molecular Weight : | 37.400kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNL ISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRL PPDMVWLPEIVLENNNDGSFQISYSCN |
Sequence Similarities : | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Delta/CHRND sub-subfamily. |
Gene Name | CHRND cholinergic receptor, nicotinic, delta [ Homo sapiens ] |
Official Symbol | CHRND |
Synonyms | CHRND; cholinergic receptor, nicotinic, delta; ACHRD, cholinergic receptor, nicotinic, delta polypeptide; acetylcholine receptor subunit delta; |
Gene ID | 1144 |
mRNA Refseq | NM_000751 |
Protein Refseq | NP_000742 |
MIM | 100720 |
Uniprot ID | Q07001 |
Chromosome Location | 2q33-qter |
Pathway | Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Highly sodium permeable acetylcholine nicotinic receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; |
Function | acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity; |
◆ Recombinant Proteins | ||
CHRND-1291H | Recombinant Human CHRND Protein, GST-Tagged | +Inquiry |
Chrnd-3056R | Recombinant Rat Chrnd, His-tagged | +Inquiry |
CHRND-26906TH | Recombinant Human CHRND | +Inquiry |
CHRND-11796Z | Recombinant Zebrafish CHRND | +Inquiry |
CHRND-2971C | Recombinant Chicken CHRND | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRND-7510HCL | Recombinant Human CHRND 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRND Products
Required fields are marked with *
My Review for All CHRND Products
Required fields are marked with *
0
Inquiry Basket