"CKMT2" Related Products

Expand
Expand

Recombinant Human CKMT2

Cat.No.: CKMT2-26702TH
Product Overview: Recombinant full length Human CKMT2 with N terminal proprietary tag, 71.83kDa.
Description: Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.
Protein length: 419 amino acids
Molecular Weight: 71.830kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Sarcomere-specific. Found only in heart and skeletal muscles.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAE VREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKV TPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFA DLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYV LSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLK GDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAG MARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNM KRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSN LGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVD TAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKK LERGQDIKVPPPLPQFGKK
Sequence Similarities: Belongs to the ATP:guanido phosphotransferase family.Contains 1 phosphagen kinase C-terminal domain.Contains 1 phosphagen kinase N-terminal domain.
Gene Name: CKMT2 creatine kinase, mitochondrial 2 (sarcomeric) [ Homo sapiens ]
Official Symbol: CKMT2
Synonyms: CKMT2; creatine kinase, mitochondrial 2 (sarcomeric); creatine kinase S-type, mitochondrial; SMTCK;
Gene ID: 1160
mRNA Refseq: NM_001099735
Protein Refseq: NP_001093205
MIM: 123295
Uniprot ID: P17540
Chromosome Location: 5
Pathway: Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem;
Function: ATP binding; creatine kinase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.