"CNTROB" Related Products

Recombinant Human CNTROB, His-tagged

Cat.No.: CNTROB-26777TH
Product Overview: Recombinant fragment, corresponding to amino acids 483-903 of Human CNTROB With N terminal His tag; 421 amino acids, 55kDa.
Description: This gene encodes a centrosomal protein that interacts with BRCA2, and is required for centriole duplication and cytokinesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 113 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KQLQDLSGQHQQELASQLAQFKVEMAEREERQQQVAEDYE LRLAREQARVCELQSGNQQLEEQRVELVERLQAMLQAH WDEANQLLSTTLPPPNPPAPPAGPSSPGPQEPEKEERR VWTMPPMAVALKPVLQQSREARDELPGAPPVLCSSSSD LSLLLGPSFQSQHSFQPLEPKPDLTSSTAGAFSALGAF HPDHRAERPFPEEDPGPDGEGLLKQGLPPAQLEGLKNFLH QLLETVPQNNENPSVDLLPPKSGPLTVPSWEEAPQVPR IPPPVHKTKVPLAMASSLFRVPEPPSSHSQGSGPSSGS PERGGDGLTFPRQLMEVSQLLRLYQARGWGALPAEDLL LYLKRLEHSGTDGRGDNVPRRNTDSRLGEIPRKEIPSQ AVPRRLATAPKTEKPPARKKSGHPAPSSMRSRGGVWR
Gene Name: CNTROB centrobin, centrosomal BRCA2 interacting protein [ Homo sapiens ]
Official Symbol: CNTROB
Synonyms: CNTROB; centrobin, centrosomal BRCA2 interacting protein; centrobin; LIP8; PP1221;
Gene ID: 116840
mRNA Refseq: NM_053051
Protein Refseq: NP_444279
MIM: 611425
Uniprot ID: Q8N137
Chromosome Location: 17p13.1
Function: protein binding; protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.