"COG4" Related Products

Recombinant Human COG4, His-tagged

Cat.No.: COG4-27221TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-478 of Human COG4 with N terminal His tag; MWt 55kDa.
Description: The protein encoded by this gene is a component of an oligomeric protein complex involved in the structure and function of the Golgi apparatus. Defects in this gene may be a cause of congenital disorder of glycosylation type IIj. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 110 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MADLDSPPKLSGVQQPSEGVGGGRCSEISAELIRSLTELQ ELEAVYERLCGEEKVVERELDALLEQQNTIESKMVTLH RMGPNLQLIEGDAKQLAGMITFTCNLAENVSSKVRQLD LAKNRLYQAIQRADDILDLKFCMDGVQTALRSEDYEQA AAHIHRYLCLDKSVIELSRQGKEGSMIDANLKLLQEAEQRLKAIVAEKFAIATKEGDLPQVERFFKIFPLLGLHEEGL RKFSEYLCKQVASKAEENLLMVLGTDMSDRRAAVIFAD TLTLLFEGIARIVETHQPIVETYYGPGRLYTLIKYLQV ECDRQVEKVVDKFIKQRDYHQQFRHVQNNLMRNSTTEK IEPRELDPILTEVTLMNARSELYLRFLKKRISSDFEVGDSMASEEVKQEHQKCLDKLLNNCLLSCTMQELIGLYVTME EYFMRETVNKAVALDTYEKGQLTSSMVDDVFYIVKKCI GRALSSSSIDCLCAMI
Gene Name: COG4 component of oligomeric golgi complex 4 [ Homo sapiens ]
Official Symbol: COG4
Synonyms: COG4; component of oligomeric golgi complex 4; conserved oligomeric Golgi complex subunit 4; COD1; DKFZP586E1519;
Gene ID: 25839
mRNA Refseq: NM_001195139
Protein Refseq: NP_001182068
MIM: 606976
Uniprot ID: Q9H9E3
Chromosome Location: 16
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.