Recombinant Human COG4, His-tagged COG4-27221TH

Recombinant Human COG4, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human COG4, His-tagged

Recombinant Human COG4, His-tagged

COG4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : COG4-27221TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-478 of Human COG4 with N terminal His tag; MWt 55kDa.
Description : The protein encoded by this gene is a component of an oligomeric protein complex involved in the structure and function of the Golgi apparatus. Defects in this gene may be a cause of congenital disorder of glycosylation type IIj. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 110 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MADLDSPPKLSGVQQPSEGVGGGRCSEISAELIRSLTELQ ELEAVYERLCGEEKVVERELDALLEQQNTIESKMVTLH RMGPNLQLIEGDAKQLAGMITFTCNLAENVSSKVRQLD LAKNRLYQAIQRADDILDLKFCMDGVQTALRSEDYEQA AAHIHRYLCLDKSVIELSRQGKEGSMIDANLKLLQEAEQRLKAIVAEKFAIATKEGDLPQVERFFKIFPLLGLHEEGL RKFSEYLCKQVASKAEENLLMVLGTDMSDRRAAVIFAD TLTLLFEGIARIVETHQPIVETYYGPGRLYTLIKYLQV ECDRQVEKVVDKFIKQRDYHQQFRHVQNNLMRNSTTEK IEPRELDPILTEVTLMNARSELYLRFLKKRISSDFEVGDSMASEEVKQEHQKCLDKLLNNCLLSCTMQELIGLYVTME EYFMRETVNKAVALDTYEKGQLTSSMVDDVFYIVKKCI GRALSSSSIDCLCAMI
Gene Name : COG4 component of oligomeric golgi complex 4 [ Homo sapiens ]
Official Symbol : COG4
Synonyms : COG4; component of oligomeric golgi complex 4; conserved oligomeric Golgi complex subunit 4; COD1; DKFZP586E1519;
Gene ID : 25839
mRNA Refseq : NM_001195139
Protein Refseq : NP_001182068
MIM : 606976
Uniprot ID : Q9H9E3
Chromosome Location : 16
Function : protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy