| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
3-199 a.a. |
| Description : |
COMMD is a new family of proteins with homology to MURR1, a multifunctional protein that inhibits NFkB. These proteins form multimeric complexes and were identified in a biochemical screen for MURR1-associated factors. The family is defined by the presence of a conserved and unique motif termed the COMM (copper metabolism gene MURR1) domain, which functions as an interface for protein-protein interactions. The prototype of this family, MURR1/COMMD1, suppresses NFkB by affecting the association of NF-kappaB with chromatin. COMMD7 (COMM domain-containing protein 7) interacts with COMMD1 via its COMM domain. It also associates with the NF-kappa-B complex and suppresses its transcriptional activity. |
| Conjugation : |
HIS |
| Form : |
Lyophilised:Reconstitution with 122 μl aqua dest. |
| Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
RLHCTEDPVPEAVGGDMQQLNQLGAQFSALTEVLFHFLTE PKEVERFLAQLSEFATTNQISLGSLRSIVKSLLLVPNG ALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPT LARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQ LKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSME CFC |