"COMMD7" Related Products

Expand
Expand

Recombinant Human COMMD7, His-tagged

Cat.No.: COMMD7-27959TH
Product Overview: Recombinant fragment, corresponding to amino acids 3-199 of Human COMMD7 with a N terminal His tag; 27kda.
Description: COMMD is a new family of proteins with homology to MURR1, a multifunctional protein that inhibits NFkB. These proteins form multimeric complexes and were identified in a biochemical screen for MURR1-associated factors. The family is defined by the presence of a conserved and unique motif termed the COMM (copper metabolism gene MURR1) domain, which functions as an interface for protein-protein interactions. The prototype of this family, MURR1/COMMD1, suppresses NFkB by affecting the association of NF-kappaB with chromatin. COMMD7 (COMM domain-containing protein 7) interacts with COMMD1 via its COMM domain. It also associates with the NF-kappa-B complex and suppresses its transcriptional activity.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 122 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RLHCTEDPVPEAVGGDMQQLNQLGAQFSALTEVLFHFLTE PKEVERFLAQLSEFATTNQISLGSLRSIVKSLLLVPNG ALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPT LARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQ LKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSME CFC
Gene Name: COMMD7 COMM domain containing 7 [ Homo sapiens ]
Official Symbol: COMMD7
Synonyms: COMMD7; COMM domain containing 7; C20orf92, chromosome 20 open reading frame 92; COMM domain-containing protein 7; dJ1085F17.3;
Gene ID: 149951
mRNA Refseq: NM_001099339
Protein Refseq: NP_001092809
Uniprot ID: Q86VX2
Chromosome Location: 20q11
Function: NF-kappaB binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.