Recombinant Human COMMD7, His-tagged

• Cat.No.: COMMD7-27959TH
• Product Overview: Recombinant fragment, corresponding to amino acids 3-199 of Human COMMD7 with a N terminal His tag; 27kda.

Specification

• Description: COMMD is a new family of proteins with homology to MURR1, a multifunctional protein that inhibits NFkB. These proteins form multimeric complexes and were identified in a biochemical screen for MURR1-associated factors. The family is defined by the presence of a conserved and unique motif termed the COMM (copper metabolism gene MURR1) domain, which functions as an interface for protein-protein interactions. The prototype of this family, MURR1/COMMD1, suppresses NFkB by affecting the association of NF-kappaB with chromatin. COMMD7 (COMM domain-containing protein 7) interacts with COMMD1 via its COMM domain. It also associates with the NF-kappa-B complex and suppresses its transcriptional activity.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitution with 122 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RLHCTEDPVPEAVGGDMQQLNQLGAQFSALTEVLFHFLTE PKEVERFLAQLSEFATTNQISLGSLRSIVKSLLLVPNG ALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPT LARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQ LKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSME CFC

Gene Information

• Gene Name: COMMD7 COMM domain containing 7 [ Homo sapiens ]
• Official Symbol: COMMD7
• Synonyms: COMMD7; COMM domain containing 7; C20orf92, chromosome 20 open reading frame 92; COMM domain-containing protein 7; dJ1085F17.3
• Gene ID: 149951
• mRNA Refseq: NM_001099339
• Protein Refseq: NP_001092809
• Uniprot ID: Q86VX2
• Chromosome Location: 20q11
• Function: NF-kappaB binding; protein binding