Recombinant Human COMMD7, His-tagged

Cat.No. : COMMD7-27959TH
Product Overview : Recombinant fragment, corresponding to amino acids 3-199 of Human COMMD7 with a N terminal His tag; 27kda.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 3-199 a.a.
Description : COMMD is a new family of proteins with homology to MURR1, a multifunctional protein that inhibits NFkB. These proteins form multimeric complexes and were identified in a biochemical screen for MURR1-associated factors. The family is defined by the presence of a conserved and unique motif termed the COMM (copper metabolism gene MURR1) domain, which functions as an interface for protein-protein interactions. The prototype of this family, MURR1/COMMD1, suppresses NFkB by affecting the association of NF-kappaB with chromatin. COMMD7 (COMM domain-containing protein 7) interacts with COMMD1 via its COMM domain. It also associates with the NF-kappa-B complex and suppresses its transcriptional activity.
Conjugation : HIS
Form : Lyophilised:Reconstitution with 122 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RLHCTEDPVPEAVGGDMQQLNQLGAQFSALTEVLFHFLTE PKEVERFLAQLSEFATTNQISLGSLRSIVKSLLLVPNG ALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPT LARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQ LKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSME CFC
Gene Name COMMD7 COMM domain containing 7 [ Homo sapiens ]
Official Symbol COMMD7
Synonyms COMMD7; COMM domain containing 7; C20orf92, chromosome 20 open reading frame 92; COMM domain-containing protein 7; dJ1085F17.3;
Gene ID 149951
mRNA Refseq NM_001099339
Protein Refseq NP_001092809
Uniprot ID Q86VX2
Chromosome Location 20q11
Function NF-kappaB binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMMD7 Products

Required fields are marked with *

My Review for All COMMD7 Products

Required fields are marked with *

0
cart-icon
0
compare icon