"COPB1" Related Products

Expand
Expand

Recombinant Human COPB1, His-tagged

Cat.No.: COPB1-27477TH
Product Overview: Recombinant fragment, corresponding to amino acids 607-953 of Human beta COP with N terminal His tag; MWt 43 kDa.
Description: This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 130 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAK LEEEKLSQKKESEKRNVTVQPDDPISFMQLTAKNEMNC KEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGF SDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLEL ATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIF GNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDA EFRQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMK CLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKP IHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTS I
Gene Name: COPB1 coatomer protein complex, subunit beta 1 [ Homo sapiens ]
Official Symbol: COPB1
Synonyms: COPB1; coatomer protein complex, subunit beta 1; coatomer protein complex, subunit beta , COPB; coatomer subunit beta;
Gene ID: 1315
mRNA Refseq: NM_001144061
Protein Refseq: NP_001137533
MIM: 600959
Uniprot ID: P53618
Chromosome Location: 11p15.2
Pathway: COPI Mediated Transport, organism-specific biosystem; Golgi to ER Retrograde Transport, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem;
Function: protein binding; structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.