"CSRP1" Related Products

Expand
Expand

Recombinant Human CSRP1

Cat.No.: CSRP1-28020TH
Product Overview: Recombinant full length Human CSRP1 with an N terminal proprietary tag; Predicted MWt 47.3 kDa.
Description: This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described.
Protein length: 193 amino acids
Molecular Weight: 47.300kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVC KKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTL STDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLAD KDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
Sequence Similarities: Contains 2 LIM zinc-binding domains.
Gene Name: CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ]
Official Symbol: CSRP1
Synonyms: CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E;
Gene ID: 1465
mRNA Refseq: NM_001193570
Protein Refseq: NP_001180499
MIM: 123876
Uniprot ID: P21291
Chromosome Location: 1q32
Function: metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.