"CTCFL" Related Products

Recombinant Human CTCFL

Cat.No.: CTCFL-27664TH
Product Overview: Recombinant fragment corresponding to amino acids 193-293 of Human BORIS with a proprietary tag at N-terminal; Predicted MWt 36.74 kDa.
Description: CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. This gene is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes, unlike CTCF which is expressed primarily in the nucleus of somatic cells. CTCF and the protein encoded by this gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation.
Protein length: 101 amino acids
Molecular Weight: 36.740kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Testis specific. Specifically expressed in primary spermatocytes.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKT
Sequence Similarities: Belongs to the CTCF zinc-finger protein family.Contains 11 C2H2-type zinc fingers.
Gene Name: CTCFL CCCTC-binding factor (zinc finger protein)-like [ Homo sapiens ]
Official Symbol: CTCFL
Synonyms: CTCFL; CCCTC-binding factor (zinc finger protein)-like; transcriptional repressor CTCFL; BORIS; cancer/testis antigen 27; CT27; dJ579F20.2;
Gene ID: 140690
mRNA Refseq: NM_080618
Protein Refseq: NP_542185
MIM: 607022
Uniprot ID: Q8NI51
Chromosome Location: 20q13.31
Function: DNA binding; histone binding; metal ion binding; protein binding; sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.