Recombinant Human CTNNA2, His-tagged CTNNA2-27148TH

Recombinant Human CTNNA2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CTNNA2, His-tagged

Recombinant Human CTNNA2, His-tagged

CTNNA2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CTNNA2-27148TH
Product Overview : Recombinant fragment, corresponding to amino acids 681-905 of Human alpha 2 Catenin isoform 2, with N terminal His tag, 225aa, MWt 26kDa,
Description : It has been shown that alpha N-catenin, a linker between cadherin adhesion receptors and the actin cytoskeleton, is essential for stabilizing dendritic spines in rodent hippocampal neurons in culture.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitution with 80 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKL ARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVK AEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKA SYVASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKP EEFQTRVRRGSQKKHISPVQALSEFKAMDSF
Gene Name : CTNNA2 catenin (cadherin-associated protein), alpha 2 [ Homo sapiens ]
Official Symbol : CTNNA2
Synonyms : CTNNA2; catenin (cadherin-associated protein), alpha 2; catenin alpha-2; cadherin associated protein; related; cancer/testis antigen 114; CAP R; CT114;
Gene ID : 1496
mRNA Refseq : NM_004389
Protein Refseq : NP_004380
MIM : 114025
Uniprot ID : P26232
Chromosome Location : 2p12-p11.1
Pathway : Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem;
Function : cadherin binding; protein binding; structural constituent of cytoskeleton;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy