Recombinant Human CTRB1

Cat.No. : CTRB1-27445TH
Product Overview : Recombinant fragment of Human CTRB1 with N terminal proprietary tag. Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is one of a family of serine proteases that is secreted into the gastrointestinal tract as an inactive precursor, which is activated by proteolytic cleavage with trypsin.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMIC
Gene Name CTRB1 chymotrypsinogen B1 [ Homo sapiens ]
Official Symbol CTRB1
Synonyms CTRB1; chymotrypsinogen B1; CTRB; chymotrypsinogen B;
Gene ID 1504
mRNA Refseq NM_001906
Protein Refseq NP_001897
MIM 118890
Uniprot ID P17538
Chromosome Location 16q23.1
Pathway Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem;
Function peptidase activity; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTRB1 Products

Required fields are marked with *

My Review for All CTRB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon