"CTRB1" Related Products

Expand
Expand
Expand

Recombinant Human CTRB1

Cat.No.: CTRB1-27445TH
Product Overview: Recombinant fragment of Human CTRB1 with N terminal proprietary tag. Predicted MW 36.63 kDa.
Description: The protein encoded by this gene is one of a family of serine proteases that is secreted into the gastrointestinal tract as an inactive precursor, which is activated by proteolytic cleavage with trypsin.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMIC
Gene Name: CTRB1 chymotrypsinogen B1 [ Homo sapiens ]
Official Symbol: CTRB1
Synonyms: CTRB1; chymotrypsinogen B1; CTRB; chymotrypsinogen B;
Gene ID: 1504
mRNA Refseq: NM_001906
Protein Refseq: NP_001897
MIM: 118890
Uniprot ID: P17538
Chromosome Location: 16q23.1
Pathway: Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem;
Function: peptidase activity; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.