Recombinant Human CTRB1

• Cat.No.: CTRB1-27445TH
• Product Overview: Recombinant fragment of Human CTRB1 with N terminal proprietary tag. Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is one of a family of serine proteases that is secreted into the gastrointestinal tract as an inactive precursor, which is activated by proteolytic cleavage with trypsin.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMIC

Gene Information

• Gene Name: CTRB1 chymotrypsinogen B1 [ Homo sapiens ]
• Official Symbol: CTRB1
• Synonyms: CTRB1; chymotrypsinogen B1; CTRB; chymotrypsinogen B
• Gene ID: 1504
• mRNA Refseq: NM_001906
• Protein Refseq: NP_001897
• MIM: 118890
• Uniprot ID: P17538
• Chromosome Location: 16q23.1
• Pathway: Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem
• Function: peptidase activity; serine-type endopeptidase activity