Recombinant Human CTRB1 Protein, His-tagged
Cat.No. : | CTRB1-852H |
Product Overview : | Recombinant Human CTRB1(Cys19-Asn263) fused with His tag at the C-terminus was produced in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Cys19-Asn263 |
Description : | Chymotrypsinogen B (CTRB1) is a 263 amino acid protein with signal peptide (1-18) and Chymotrypsinogen B (19-263). Chymotrypsinogen B have three chains:Chymotrypsin B chain A(19-31), Chymotrypsin B chain B(34-164), Chymotrypsin B chain C (167-263). Chymotrypsinogen B is a Serine Protease Hydrolase secrets into gastrointestinal tract as the inactive precursor Chymotrypsinogen. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0. |
AA sequence : | CGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDV VVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDF PAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDS GGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAANVDHHHHHH |
Endotoxin : | Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Shipping : | The product is shipped on dry ice/ice packs. |
Gene Name | CTRB1 chymotrypsinogen B1 [ Homo sapiens ] |
Official Symbol | CTRB1 |
Synonyms | CTRB1; chymotrypsinogen B1; CTRB; chymotrypsinogen B; FLJ42412; MGC88037; |
Gene ID | 1504 |
mRNA Refseq | NM_001906 |
Protein Refseq | NP_001897 |
MIM | 118890 |
UniProt ID | P17538 |
◆ Recombinant Proteins | ||
CTRB1-2060M | Recombinant Mouse CTRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTRB1-1084R | Recombinant Rhesus monkey CTRB1 Protein, His-tagged | +Inquiry |
CTRB1-4041M | Recombinant Mouse CTRB1 Protein | +Inquiry |
CTRB1-27445TH | Recombinant Human CTRB1 | +Inquiry |
CTRB1-1660R | Recombinant Rat CTRB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTRB1-7194HCL | Recombinant Human CTRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTRB1 Products
Required fields are marked with *
My Review for All CTRB1 Products
Required fields are marked with *