Recombinant Human CTRB1 Protein, His-tagged

Cat.No. : CTRB1-852H
Product Overview : Recombinant Human CTRB1(Cys19-Asn263) fused with His tag at the C-terminus was produced in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Cys19-Asn263
Description : Chymotrypsinogen B (CTRB1) is a 263 amino acid protein with signal peptide (1-18) and Chymotrypsinogen B (19-263). Chymotrypsinogen B have three chains:Chymotrypsin B chain A(19-31), Chymotrypsin B chain B(34-164), Chymotrypsin B chain C (167-263). Chymotrypsinogen B is a Serine Protease Hydrolase secrets into gastrointestinal tract as the inactive precursor Chymotrypsinogen.
Form : Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
AA sequence : CGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDV VVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDF PAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDS GGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAANVDHHHHHH
Endotoxin : Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Shipping : The product is shipped on dry ice/ice packs.
Gene Name CTRB1 chymotrypsinogen B1 [ Homo sapiens ]
Official Symbol CTRB1
Synonyms CTRB1; chymotrypsinogen B1; CTRB; chymotrypsinogen B; FLJ42412; MGC88037;
Gene ID 1504
mRNA Refseq NM_001906
Protein Refseq NP_001897
MIM 118890
UniProt ID P17538

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTRB1 Products

Required fields are marked with *

My Review for All CTRB1 Products

Required fields are marked with *

0
cart-icon