Recombinant Human CTRB1 Protein, His-tagged

• Cat.No.: CTRB1-852H
• Product Overview: Recombinant Human CTRB1(Cys19-Asn263) fused with His tag at the C-terminus was produced in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Cys19-Asn263
• Description: Chymotrypsinogen B (CTRB1) is a 263 amino acid protein with signal peptide (1-18) and Chymotrypsinogen B (19-263). Chymotrypsinogen B have three chains:Chymotrypsin B chain A(19-31), Chymotrypsin B chain B(34-164), Chymotrypsin B chain C (167-263). Chymotrypsinogen B is a Serine Protease Hydrolase secrets into gastrointestinal tract as the inactive precursor Chymotrypsinogen.
• Form: Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
• AA sequence: CGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDV VVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDF PAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDS GGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAANVDHHHHHH
• Endotoxin: Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.
  Please minimize freeze-thaw cycles.
• Shipping: The product is shipped on dry ice/ice packs.

Gene Information

• Gene Name: CTRB1 chymotrypsinogen B1 [ Homo sapiens ]
• Official Symbol: CTRB1
• Synonyms: CTRB1; chymotrypsinogen B1; CTRB; chymotrypsinogen B; FLJ42412; MGC88037
• Gene ID: 1504
• mRNA Refseq: NM_001906
• Protein Refseq: NP_001897
• MIM: 118890
• UniProt ID: P17538