"DPYSL3" Related Products

Expand
Expand
Expand

Recombinant Human DPYSL3, His-tagged

Cat.No.: DPYSL3-26940TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-539 of Human CRMP4 with an N terminal His tag. MWt ~62 kDa,
Description: Dihydropyrimidinase-related protein 3 is an enzyme that in humans is encoded by the DPYSL3 gene.
Conjugation: HIS
Source: E. coli
Form: Liquid
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: (Amino acid sequence (Sequence determined by 5 Sequencing))MSYQGKKNIPRITSDRLLIKGGRIVN DDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKM VIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMI IDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDIT HWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELY EIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGP EGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSK SAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKA AAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTF STAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGK MDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDP DAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQGKI MLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLH AVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPV RNLHQSGFS
Gene Name: DPYSL3 dihydropyrimidinase-like 3 [ Homo sapiens ]
Official Symbol: DPYSL3
Synonyms: DPYSL3; dihydropyrimidinase-like 3; dihydropyrimidinase-related protein 3; CRMP4; DRP 3; ULIP;
Gene ID: 1809
mRNA Refseq: NM_001197294
Protein Refseq: NP_001184223
MIM: 601168
Uniprot ID: Q14195
Chromosome Location: 5q32
Pathway: Axon guidance, organism-specific biosystem; CRMPs in Sema3A signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Semaphorin interactions, organism-specific biosystem;
Function: dihydropyrimidinase activity; phosphoprotein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.