"E2F6" Related Products

Expand
Expand

Recombinant Human E2F6

Cat.No.: E2F6-26508TH
Product Overview: Recombinant full length Human E2F6 with N-terminal proprietary tag.Mol Wt 56.65 kDa inclusive of tag.
Description: This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins. They are also a target of the transforming proteins of small DNA tumor viruses. Many E2F proteins contain several evolutionarily conserved domains: a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. The encoded protein of this gene is atypical because it lacks the transactivation and tumor suppressor protein association domains. It contains a modular suppression domain and is an inhibitor of E2F-dependent transcription. The protein is part of a multimeric protein complex that contains a histone methyltransferase and the transcription factors Mga and Max. Multiple transcript variants have been reported for this gene, but it has not been clearly demonstrated that they encode valid isoforms.
Protein length: 281 amino acids
Molecular Weight: 56.650kDa
Source: Wheat germ
Tissue specificity: Expressed in all tissues examined. Highest levels in placenta, skeletal muscle, heart, ovary, kidney, small intestine and spleen.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKI RINLEDNVQYVSMRKALKVKRPRFDVSLVYLTRKFMDLVR SAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS KNHIRWIGSDLSNFGAVPQQKKLQEELSDLSAMEDALDEL IKDCAQQLFELTDDKENERLAYVTYQDIHSIQAFHEQIVI AVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQ GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVS N
Sequence Similarities: Belongs to the E2F/DP family.
Gene Name: E2F6 E2F transcription factor 6 [ Homo sapiens ]
Official Symbol: E2F6
Synonyms: E2F6; E2F transcription factor 6; transcription factor E2F6; E2F 6;
Gene ID: 1876
mRNA Refseq: NM_198256
Protein Refseq: NP_937987
MIM: 602944
Uniprot ID: O75461
Chromosome Location: 2p25.1
Pathway: Cell cycle, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; G1 to S cell cycle control, organism-specific biosystem;
Function: DNA binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.