Recombinant Full Length Human E2F6 Protein
Cat.No. : | E2F6-135HF |
Product Overview : | Recombinant full length Human E2F6 with N-terminal proprietary tag.Mol Wt 56.65 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 281 amino acids |
Description : | This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins. They are also a target of the transforming proteins of small DNA tumor viruses. Many E2F proteins contain several evolutionarily conserved domains: a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. The encoded protein of this gene is atypical because it lacks the transactivation and tumor suppressor protein association domains. It contains a modular suppression domain and is an inhibitor of E2F-dependent transcription. The protein is part of a multimeric protein complex that contains a histone methyltransferase and the transcription factors Mga and Max. Multiple transcript variants have been reported for this gene, but it has not been clearly demonstrated that they encode valid isoforms. |
Form : | Liquid |
Molecular Mass : | 56.650kDa |
AA Sequence : | MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKI RINLEDNVQYVSMRKALKVKRPRFDVSLVYLTRKFMDLVR SAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS KNHIRWIGSDLSNFGAVPQQKKLQEELSDLSAMEDALDEL IKDCAQQLFELTDDKENERLAYVTYQDIHSIQAFHEQIVI AVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQ GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVS N |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | E2F6 E2F transcription factor 6 [ Homo sapiens ] |
Official Symbol | E2F6 |
Synonyms | E2F6; E2F transcription factor 6; transcription factor E2F6; |
Gene ID | 1876 |
mRNA Refseq | NM_198256 |
Protein Refseq | NP_937987 |
MIM | 602944 |
UniProt ID | O75461 |
◆ Recombinant Proteins | ||
E2F6-2599M | Recombinant Mouse E2F6 Protein, His (Fc)-Avi-tagged | +Inquiry |
E2F6-221C | Recombinant Cynomolgus Monkey E2F6 Protein, His (Fc)-Avi-tagged | +Inquiry |
E2F6-475C | Recombinant Cynomolgus E2F6 Protein, His-tagged | +Inquiry |
E2F6-4935M | Recombinant Mouse E2F6 Protein | +Inquiry |
E2F6-1193R | Recombinant Rhesus Macaque E2F6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
E2F6-521HCL | Recombinant Human E2F6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E2F6 Products
Required fields are marked with *
My Review for All E2F6 Products
Required fields are marked with *
0
Inquiry Basket