Recombinant Full Length Human E2F6 Protein

Cat.No. : E2F6-135HF
Product Overview : Recombinant full length Human E2F6 with N-terminal proprietary tag.Mol Wt 56.65 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 281 amino acids
Description : This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins. They are also a target of the transforming proteins of small DNA tumor viruses. Many E2F proteins contain several evolutionarily conserved domains: a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. The encoded protein of this gene is atypical because it lacks the transactivation and tumor suppressor protein association domains. It contains a modular suppression domain and is an inhibitor of E2F-dependent transcription. The protein is part of a multimeric protein complex that contains a histone methyltransferase and the transcription factors Mga and Max. Multiple transcript variants have been reported for this gene, but it has not been clearly demonstrated that they encode valid isoforms.
Form : Liquid
Molecular Mass : 56.650kDa
AA Sequence : MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKI RINLEDNVQYVSMRKALKVKRPRFDVSLVYLTRKFMDLVR SAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS KNHIRWIGSDLSNFGAVPQQKKLQEELSDLSAMEDALDEL IKDCAQQLFELTDDKENERLAYVTYQDIHSIQAFHEQIVI AVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQ GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVS N
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name E2F6 E2F transcription factor 6 [ Homo sapiens ]
Official Symbol E2F6
Synonyms E2F6; E2F transcription factor 6; transcription factor E2F6;
Gene ID 1876
mRNA Refseq NM_198256
Protein Refseq NP_937987
MIM 602944
UniProt ID O75461

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E2F6 Products

Required fields are marked with *

My Review for All E2F6 Products

Required fields are marked with *

0
cart-icon