"EIF2D" Related Products

Expand
Expand
Expand

Recombinant Human EIF2D

Cat.No.: EIF2D-28492TH
Product Overview: Recombinant fragment of Human EIF2D with N terminal proprietary tag. Predicted MW 36.63 kDa.
Description: This gene encodes a translation initiation factor involved in the recruitment and delivery of aminoacyl-tRNAs to the P-site of the eukaryotic ribosome in a GTP-independent manner. This gene was previously referred to as ligatin, but is now known to localize to the cytoplasm and localize and function with translation factors. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK
Sequence Similarities: Belongs to the ligatin family.Contains 1 PUA domain.Contains 1 SUI1 domain.
Gene Name: EIF2D eukaryotic translation initiation factor 2D [ Homo sapiens ]
Official Symbol: EIF2D
Synonyms: EIF2D; eukaryotic translation initiation factor 2D; LGTN;
Gene ID: 1939
mRNA Refseq: NM_001201478
Protein Refseq: NP_001188407
MIM: 613709
Uniprot ID: P41214
Chromosome Location: 1q32.1
Function: RNA binding; receptor activity; translation initiation factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.