Recombinant Human EIF2D
Cat.No. : | EIF2D-28492TH |
Product Overview : | Recombinant fragment of Human EIF2D with N terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a translation initiation factor involved in the recruitment and delivery of aminoacyl-tRNAs to the P-site of the eukaryotic ribosome in a GTP-independent manner. This gene was previously referred to as ligatin, but is now known to localize to the cytoplasm and localize and function with translation factors. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK |
Sequence Similarities : | Belongs to the ligatin family.Contains 1 PUA domain.Contains 1 SUI1 domain. |
Gene Name | EIF2D eukaryotic translation initiation factor 2D [ Homo sapiens ] |
Official Symbol | EIF2D |
Synonyms | EIF2D; eukaryotic translation initiation factor 2D; LGTN; |
Gene ID | 1939 |
mRNA Refseq | NM_001201478 |
Protein Refseq | NP_001188407 |
MIM | 613709 |
Uniprot ID | P41214 |
Chromosome Location | 1q32.1 |
Function | RNA binding; receptor activity; translation initiation factor activity; |
◆ Recombinant Proteins | ||
EIF2D-330H | Recombinant Human EIF2D Protein, MYC/DDK-tagged | +Inquiry |
EIF2D-5086M | Recombinant Mouse EIF2D Protein | +Inquiry |
EIF2D-11380Z | Recombinant Zebrafish EIF2D | +Inquiry |
EIF2D-5604H | Recombinant Human EIF2D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF2D-1708R | Recombinant Rat EIF2D Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2D-541HCL | Recombinant Human EIF2D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2D Products
Required fields are marked with *
My Review for All EIF2D Products
Required fields are marked with *