Recombinant Human EIF2D

Cat.No. : EIF2D-28492TH
Product Overview : Recombinant fragment of Human EIF2D with N terminal proprietary tag. Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a translation initiation factor involved in the recruitment and delivery of aminoacyl-tRNAs to the P-site of the eukaryotic ribosome in a GTP-independent manner. This gene was previously referred to as ligatin, but is now known to localize to the cytoplasm and localize and function with translation factors. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK
Sequence Similarities : Belongs to the ligatin family.Contains 1 PUA domain.Contains 1 SUI1 domain.
Gene Name EIF2D eukaryotic translation initiation factor 2D [ Homo sapiens ]
Official Symbol EIF2D
Synonyms EIF2D; eukaryotic translation initiation factor 2D; LGTN;
Gene ID 1939
mRNA Refseq NM_001201478
Protein Refseq NP_001188407
MIM 613709
Uniprot ID P41214
Chromosome Location 1q32.1
Function RNA binding; receptor activity; translation initiation factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF2D Products

Required fields are marked with *

My Review for All EIF2D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon