"EIF3E" Related Products

Expand

Recombinant Human EIF3E

Cat.No.: EIF3E-26385TH
Product Overview: Recombinant full length Human eIF3e with N terminal proprietary tag; Predicted MWt 75.02 kDa inclusive of tag.
Description: eIF3e is part of the eIF3 complex, which is composed of at least 12 subunits. It binds the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. It can bind the COP9 signalosome and the 26S proteasome, possibly having regulatory functions in both protein translation and degradation. Reducing its expression by RNA interference in HeLa cells markedly alters mitosis progression and defects in spindle formation, chromosome segregation and cytokinesis are observed.
Protein length: 445 amino acids
Molecular Weight: 75.020kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQG KLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQ LKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPA TDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNS VSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQP QYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKV IQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLV NDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKL NMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSP YQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQ DSGFY
Gene Name: EIF3E eukaryotic translation initiation factor 3, subunit E [ Homo sapiens ]
Official Symbol: EIF3E
Synonyms: EIF3E; eukaryotic translation initiation factor 3, subunit E; EIF3S6, eukaryotic translation initiation factor 3, subunit 6 48kDa , INT6; eukaryotic translation initiation factor 3 subunit E; eIF3 p48; eIF3e;
Gene ID: 3646
mRNA Refseq: NM_001568
Protein Refseq: NP_001559
MIM: 602210
Uniprot ID: P60228
Chromosome Location: 8q22-q23
Pathway: Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem;
Function: protein N-terminus binding; protein binding; translation initiation factor activity; contributes_to translation initiation factor activity; contributes_to translation initiation factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.