Recombinant Human EIF3E protein, His-tagged

• Cat.No.: EIF3E-3596H
• Product Overview: Recombinant Human EIF3E protein(146-445 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 146-445 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: GAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: EIF3E eukaryotic translation initiation factor 3, subunit E [ Homo sapiens ]
• Official Symbol: EIF3E
• Synonyms: EIF3E; eukaryotic translation initiation factor 3, subunit E; EIF3S6, eukaryotic translation initiation factor 3, subunit 6 48kDa , INT6; eukaryotic translation initiation factor 3 subunit E; eIF3 p48; eIF3e; eIF-3 p48; mammary tumor-associated protein INT6; viral integration site protein INT-6 homolog; eukaryotic translation initiation factor 3 subunit 6; murine mammary tumor integration site 6 (oncogene homolog); eukaryotic translation initiation factor 3, subunit 6 48kDa; eukaryotic translation initiation factor 3, subunit 6 (48kD); INT6; EIF3S6; EIF3-P48; eIF3-p46
• Gene ID: 3646
• mRNA Refseq: NM_001568
• Protein Refseq: NP_001559
• MIM: 602210
• UniProt ID: P60228