Recombinant Human EIF3K, His-tagged
Cat.No. : | EIF3K-27408TH |
Product Overview : | Recombinant fragment: VLKLYQFNPA FFQTTVTAQI LLKALTNLPH TDFTLCKCMI DQAHQ, corresponding to amino acids 50-94 of Human eIF3K fused to a His tag at N-terminal end, 10kDa. |
- Specification
- Gene Information
- Related Products
Description : | The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitous, with the highest levels of expression in brain, testis and kidney. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: PBS |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQ |
Sequence Similarities : | Belongs to the eIF-3 subunit K family. |
Gene Name : | EIF3K eukaryotic translation initiation factor 3, subunit K [ Homo sapiens ] |
Official Symbol : | EIF3K |
Synonyms : | EIF3K; eukaryotic translation initiation factor 3, subunit K; EIF3S12, eukaryotic translation initiation factor 3, subunit 12; eukaryotic translation initiation factor 3 subunit K; ARG134; eIF3k; HSPC029; M9; PLAC 24; PRO1474; PTD001; |
Gene ID : | 27335 |
mRNA Refseq : | NM_013234 |
Protein Refseq : | NP_037366 |
MIM : | 609596 |
Uniprot ID : | Q9UBQ5 |
Chromosome Location : | 19q13.2 |
Pathway : | Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem; |
Function : | binding; ribosome binding; contributes_to translation initiation factor activity; contributes_to translation initiation factor activity; |
Products Types
◆ Recombinant Protein | ||
EIF3K-2713M | Recombinant Mouse EIF3K Protein, His (Fc)-Avi-tagged | +Inquiry |
Eif3k-2782M | Recombinant Mouse Eif3k Protein, Myc/DDK-tagged | +Inquiry |
EIF3K-1249R | Recombinant Rhesus Macaque EIF3K Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3K-3191H | Recombinant Human EIF3K Protein, GST-tagged | +Inquiry |
EIF3K-2361Z | Recombinant Zebrafish EIF3K | +Inquiry |
◆ Lysates | ||
EIF3K-001HCL | Recombinant Human EIF3K cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket