"EIF5A2" Related Products

Expand
Expand
Expand

Recombinant Human EIF5A2, His-tagged

Cat.No.: EIF5A2-27178TH
Product Overview: Recombinant full length Human eIF5A2 with N terminal His tag; 173 amino acids with tag, Predicted MWt 18.9kDa.
Description: Eukaryotic translation initiation factor 5A-2 is a protein that in humans is encoded by the EIF5A2 gene.
Protein length: 153 amino acids
Conjugation: HIS
Molecular Weight: 18.900kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells.
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Sequence Similarities: Belongs to the eIF-5A family.
Gene Name: EIF5A2 eukaryotic translation initiation factor 5A2 [ Homo sapiens ]
Official Symbol: EIF5A2
Synonyms: EIF5A2; eukaryotic translation initiation factor 5A2; eukaryotic translation initiation factor 5A-2;
Gene ID: 56648
mRNA Refseq: NM_020390
Protein Refseq: NP_065123
MIM: 605782
Uniprot ID: Q9GZV4
Chromosome Location: 3q26.2
Pathway: Hypusine synthesis from eIF5A-lysine, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem;
Function: RNA binding; protein binding; ribosome binding; translation elongation factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.