Recombinant Human EIF5A2, His-tagged

Cat.No. : EIF5A2-27178TH
Product Overview : Recombinant full length Human eIF5A2 with N terminal His tag; 173 amino acids with tag, Predicted MWt 18.9kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 153 amino acids
Description : Eukaryotic translation initiation factor 5A-2 is a protein that in humans is encoded by the EIF5A2 gene.
Conjugation : HIS
Molecular Weight : 18.900kDa inclusive of tags
Tissue specificity : Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells.
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Sequence Similarities : Belongs to the eIF-5A family.
Gene Name EIF5A2 eukaryotic translation initiation factor 5A2 [ Homo sapiens ]
Official Symbol EIF5A2
Synonyms EIF5A2; eukaryotic translation initiation factor 5A2; eukaryotic translation initiation factor 5A-2;
Gene ID 56648
mRNA Refseq NM_020390
Protein Refseq NP_065123
MIM 605782
Uniprot ID Q9GZV4
Chromosome Location 3q26.2
Pathway Hypusine synthesis from eIF5A-lysine, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem;
Function RNA binding; protein binding; ribosome binding; translation elongation factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF5A2 Products

Required fields are marked with *

My Review for All EIF5A2 Products

Required fields are marked with *

0
cart-icon
0
compare icon