Recombinant Full Length Human EIF5A2 Protein, GST-tagged
Cat.No. : | EIF5A2-4301HF |
Product Overview : | Human EIF5A2 full-length ORF ( AAH36072, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 153 amino acids |
Description : | EIF5A2 (Eukaryotic Translation Initiation Factor 5A2) is a Protein Coding gene. Among its related pathways are Gamma carboxylation, hypusine formation and arylsulfatase activation and Metabolism of proteins. GO annotations related to this gene include RNA binding and translation elongation factor activity. An important paralog of this gene is EIF5A. |
Molecular Mass : | 42.46 kDa |
AA Sequence : | MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF5A2 eukaryotic translation initiation factor 5A2 [ Homo sapiens ] |
Official Symbol | EIF5A2 |
Synonyms | EIF5A2; eukaryotic translation initiation factor 5A2; eukaryotic translation initiation factor 5A-2; eIF-5A-2; eukaryotic initiation factor 5A; EIF-5A2; eIF5AII; |
Gene ID | 56648 |
mRNA Refseq | NM_020390 |
Protein Refseq | NP_065123 |
MIM | 605782 |
UniProt ID | Q9GZV4 |
◆ Recombinant Proteins | ||
EIF5A2-238H | Recombinant Human EIF5A2, His tagged | +Inquiry |
EIF5A2-3580H | Recombinant Human EIF5A2 Protein (Met1-Lys153), N-His tagged | +Inquiry |
EIF5A2-27178TH | Recombinant Human EIF5A2, His-tagged | +Inquiry |
EIF5A2-1278H | Recombinant Human EIF5A2 protein, His-tagged | +Inquiry |
Eif5a2-2793M | Recombinant Mouse Eif5a2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF5A2-6640HCL | Recombinant Human EIF5A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF5A2 Products
Required fields are marked with *
My Review for All EIF5A2 Products
Required fields are marked with *
0
Inquiry Basket