Recombinant Human ELP2, His-tagged
Cat.No. : | ELP2-30857TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 552-826 of Human STATIP1 with an N terminal His tag. 34 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 552-826 a.a. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 163 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKK EHAAIILWNTTSWKQVQNLVFHSLTVTQMAFSPNEKFL LAVSRDRTWSLWKKQDTISPEFEPVFSLFAFTNKITSVHSRIIWSCDWSPDSKYFFTGSRDKKVVVWGECDSTDDCIE HNIGPCSSVLDVGGAVTAVSVCPVLHPSQRYVVAVGLE CGKICLYTWKKTDQVPEINDWTHCVETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNK CAL |
Sequence Similarities : | Belongs to the WD repeat ELP2 family.Contains 14 WD repeats. |
Gene Name | ELP2 elongation protein 2 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ELP2 |
Synonyms | ELP2; elongation protein 2 homolog (S. cerevisiae); signal transducer and activator of transcription 3 interacting protein 1 , STATIP1; elongator complex protein 2; FLJ10879; StIP; |
Gene ID | 55250 |
mRNA Refseq | NM_001242879 |
Protein Refseq | NP_001229808 |
Uniprot ID | Q6IA86 |
Chromosome Location | 18q12.1 |
Function | contributes_to DNA binding; protein kinase binding; |
◆ Recombinant Proteins | ||
ELP2-4026Z | Recombinant Zebrafish ELP2 | +Inquiry |
ELP2-3992H | Recombinant Human ELP2, MYC/DDK-tagged | +Inquiry |
ELP2-7900HFL | Recombinant Full Length Human ELP2, Flag-tagged | +Inquiry |
ELP2-2082R | Recombinant Rat ELP2 Protein | +Inquiry |
ELP2-1739R | Recombinant Rat ELP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELP2-6616HCL | Recombinant Human ELP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELP2 Products
Required fields are marked with *
My Review for All ELP2 Products
Required fields are marked with *