Recombinant Human ELP2, His-tagged
| Cat.No. : | ELP2-30857TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 552-826 of Human STATIP1 with an N terminal His tag. 34 kDa ; | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 552-826 a.a. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 163 μl distilled water. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | LQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKK EHAAIILWNTTSWKQVQNLVFHSLTVTQMAFSPNEKFL LAVSRDRTWSLWKKQDTISPEFEPVFSLFAFTNKITSVHSRIIWSCDWSPDSKYFFTGSRDKKVVVWGECDSTDDCIE HNIGPCSSVLDVGGAVTAVSVCPVLHPSQRYVVAVGLE CGKICLYTWKKTDQVPEINDWTHCVETSQSQSHTLAIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNK CAL | 
| Sequence Similarities : | Belongs to the WD repeat ELP2 family.Contains 14 WD repeats. | 
| Gene Name | ELP2 elongation protein 2 homolog (S. cerevisiae) [ Homo sapiens ] | 
| Official Symbol | ELP2 | 
| Synonyms | ELP2; elongation protein 2 homolog (S. cerevisiae); signal transducer and activator of transcription 3 interacting protein 1 , STATIP1; elongator complex protein 2; FLJ10879; StIP; | 
| Gene ID | 55250 | 
| mRNA Refseq | NM_001242879 | 
| Protein Refseq | NP_001229808 | 
| Uniprot ID | Q6IA86 | 
| Chromosome Location | 18q12.1 | 
| Function | contributes_to DNA binding; protein kinase binding; | 
| ◆ Recombinant Proteins | ||
| ELP2-4026Z | Recombinant Zebrafish ELP2 | +Inquiry | 
| ELP2-2756M | Recombinant Mouse ELP2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ELP2-1983H | Recombinant Human ELP2, GST-tagged | +Inquiry | 
| ELP2-2082R | Recombinant Rat ELP2 Protein | +Inquiry | 
| ELP2-1739R | Recombinant Rat ELP2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ELP2-6616HCL | Recombinant Human ELP2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELP2 Products
Required fields are marked with *
My Review for All ELP2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            