Recombinant Human EMP3
| Cat.No. : | EMP3-28552TH |
| Product Overview : | Recombinant fragment of Human EMP3 with N-terminal proprietary tag. Predicted MW 30.47 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | Epithelial membrane protein 3 is a protein that in humans is encoded by the EMP3 gene. |
| Protein length : | 44 amino acids |
| Molecular Weight : | 30.470kDa |
| Source : | Wheat germ |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQV |
| Sequence Similarities : | Belongs to the PMP-22/EMP/MP20 family. |
| Gene Name : | EMP3 epithelial membrane protein 3 [ Homo sapiens ] |
| Official Symbol : | EMP3 |
| Synonyms : | EMP3; epithelial membrane protein 3; YMP; |
| Gene ID : | 2014 |
| mRNA Refseq : | NM_001425 |
| Protein Refseq : | NP_001416 |
| MIM : | 602335 |
| Uniprot ID : | P54852 |
| Chromosome Location : | 19q13.3 |
Products Types
| ◆ Recombinant Protein | ||
| EMP3-2780M | Recombinant Mouse EMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EMP3-1292R | Recombinant Rhesus Macaque EMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EMP3-3288H | Recombinant Human EMP3 Protein, GST-tagged | +Inquiry |
| Emp3-2817M | Recombinant Mouse Emp3 Protein, Myc/DDK-tagged | +Inquiry |
| EMP3-1753R | Recombinant Rat EMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Lysates | ||
| EMP3-6605HCL | Recombinant Human EMP3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
