"EMP3" Related Products

Expand

Recombinant Human EMP3

Cat.No.: EMP3-28552TH
Product Overview: Recombinant fragment of Human EMP3 with N-terminal proprietary tag. Predicted MW 30.47 kDa.
Description: Epithelial membrane protein 3 is a protein that in humans is encoded by the EMP3 gene.
Protein length: 44 amino acids
Molecular Weight: 30.470kDa
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQV
Sequence Similarities: Belongs to the PMP-22/EMP/MP20 family.
Gene Name: EMP3 epithelial membrane protein 3 [ Homo sapiens ]
Official Symbol: EMP3
Synonyms: EMP3; epithelial membrane protein 3; YMP;
Gene ID: 2014
mRNA Refseq: NM_001425
Protein Refseq: NP_001416
MIM: 602335
Uniprot ID: P54852
Chromosome Location: 19q13.3

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.