Recombinant Human EMP3 Protein, GST-tagged
| Cat.No. : | EMP3-3288H |
| Product Overview : | Human EMP3 full-length ORF ( AAH09718, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the PMP-22/EMP/MP20 family of proteins. The protein contains four transmembrane domains and two N-linked glycosylation sites. It is thought to be involved in cell proliferation, cell-cell interactions and function as a tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
| Molecular Mass : | 43.67 kDa |
| AA Sequence : | MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EMP3 epithelial membrane protein 3 [ Homo sapiens ] |
| Official Symbol | EMP3 |
| Synonyms | EMP3; epithelial membrane protein 3; YMP; EMP-3; HNMP-1; hematopoietic neural membrane protein 1; |
| Gene ID | 2014 |
| mRNA Refseq | NM_001425 |
| Protein Refseq | NP_001416 |
| MIM | 602335 |
| UniProt ID | P54852 |
| ◆ Recombinant Proteins | ||
| EMP3-1467R | Recombinant Rhesus monkey EMP3 Protein, His-tagged | +Inquiry |
| EMP3-3288H | Recombinant Human EMP3 Protein, GST-tagged | +Inquiry |
| EMP3-153HF | Recombinant Full Length Human EMP3 Protein | +Inquiry |
| RFL32256RF | Recombinant Full Length Rat Epithelial Membrane Protein 3(Emp3) Protein, His-Tagged | +Inquiry |
| RFL2918BF | Recombinant Full Length Bovine Epithelial Membrane Protein 3(Emp3) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EMP3-6605HCL | Recombinant Human EMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMP3 Products
Required fields are marked with *
My Review for All EMP3 Products
Required fields are marked with *
