"ENOPH1" Related Products

Expand

Recombinant Human ENOPH1, His-tagged

Cat.No.: ENOPH1-29130TH
Product Overview: Recombinant full length Human MASA (amino acids 1-261) with an N terminal His tag; 281aa, Molecular Weight: 31kDa inclusive of tag.
Protein length: 261 amino acids
Conjugation: HIS
Molecular Weight: 31.000kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
Sequence Similarities: Belongs to the HAD-like hydrolase superfamily. MasA/mtnC family.
Gene Name: ENOPH1 enolase-phosphatase 1 [ Homo sapiens ]
Official Symbol: ENOPH1
Synonyms: ENOPH1; enolase-phosphatase 1; enolase-phosphatase E1; acireductone synthase; E1; Enolase phosphatase E1; MASA;
Gene ID: 58478
mRNA Refseq: NM_021204
Protein Refseq: NP_067027
Uniprot ID: Q9UHY7
Chromosome Location: 4q21.3
Pathway: Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Metabolism of polyamines, organism-specific biosystem;
Function: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity; 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity; acireductone synthase activity; acireductone synthase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.