Recombinant Human ENOPH1, His-tagged

Cat.No. : ENOPH1-29130TH
Product Overview : Recombinant full length Human MASA (amino acids 1-261) with an N terminal His tag; 281aa, Molecular Weight: 31kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 261 amino acids
Conjugation : HIS
Molecular Weight : 31.000kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
Sequence Similarities : Belongs to the HAD-like hydrolase superfamily. MasA/mtnC family.
Gene Name ENOPH1 enolase-phosphatase 1 [ Homo sapiens ]
Official Symbol ENOPH1
Synonyms ENOPH1; enolase-phosphatase 1; enolase-phosphatase E1; acireductone synthase; E1; Enolase phosphatase E1; MASA;
Gene ID 58478
mRNA Refseq NM_021204
Protein Refseq NP_067027
Uniprot ID Q9UHY7
Chromosome Location 4q21.3
Pathway Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Metabolism of polyamines, organism-specific biosystem;
Function 2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity; 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity; acireductone synthase activity; acireductone synthase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENOPH1 Products

Required fields are marked with *

My Review for All ENOPH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon