Recombinant Human ENOPH1 protein, GST-tagged
Cat.No. : | ENOPH1-8433H |
Product Overview : | Recombinant Human ENOPH1 protein(1-115 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-115 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | ENOPH1 |
Synonyms | ENOPH1; enolase-phosphatase 1; enolase-phosphatase E1; acireductone synthase; E1; Enolase phosphatase E1; MASA; MASA homolog; 2,3-diketo-5-methylthio-1-phosphopentane phosphatase; MST145; FLJ12594; DKFZp586M0524; |
Gene ID | 58478 |
mRNA Refseq | NM_021204 |
Protein Refseq | NP_067027 |
UniProt ID | Q9UHY7 |
◆ Recombinant Proteins | ||
Enoph1-2828M | Recombinant Mouse Enoph1 Protein, Myc/DDK-tagged | +Inquiry |
ENOPH1-1758R | Recombinant Rat ENOPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENOPH1-3457H | Recombinant Human ENOPH1 protein, His-tagged | +Inquiry |
ENOPH1-5207M | Recombinant Mouse ENOPH1 Protein | +Inquiry |
ENOPH1-2795M | Recombinant Mouse ENOPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENOPH1-6597HCL | Recombinant Human ENOPH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENOPH1 Products
Required fields are marked with *
My Review for All ENOPH1 Products
Required fields are marked with *
0
Inquiry Basket