Recombinant Human EVL, His-tagged EVL-28553TH

Recombinant Human EVL, His-tagged

PRODUCTS

Home / Products / Recombinant Human EVL, His-tagged

Recombinant Human EVL, His-tagged

EVL Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : EVL-28553TH
Product Overview : Recombinant fragment, corresponding to amino acids 26-268 of Human Enah/Vasp-like with N terminal His tag; 243 amino acids, 28kDa.
Description : Ena/VASP-like protein is a member of the Ena/VASP family of proteins that in humans is encoded by the EVL gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 99 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINY SIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTF SNAMLFALNIMNSQEGGPSSQRQVQNGPSPDEMDIQRRQVMEQHQQQRQESLERRTSATGPILPPGHPSSAASAPVSC SGPPPPPPPPVPPPPTGATPPPPPPLPAGGAQGSSHDE SSMSGLAAAIAGAKLRRVQRPEDASGGSSPSGTSKSDANR ASSGGGGGG
Gene Name : EVL Enah/Vasp-like [ Homo sapiens ]
Official Symbol : EVL
Synonyms : EVL; Enah/Vasp-like; ena/VASP-like protein; RNB6;
Gene ID : 51466
mRNA Refseq : NM_016337
Protein Refseq : NP_057421
Uniprot ID : Q9UI08
Chromosome Location : 14q32.32
Pathway : Adaptive Immune System, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Generation of second messenger molecules, organism-specific biosystem; Immune System, organism-specific biosystem;
Function : SH3 domain binding; actin binding; profilin binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy