"EVL" Related Products

Expand

Recombinant Human EVL, His-tagged

Cat.No.: EVL-28553TH
Product Overview: Recombinant fragment, corresponding to amino acids 26-268 of Human Enah/Vasp-like with N terminal His tag; 243 amino acids, 28kDa.
Description: Ena/VASP-like protein is a member of the Ena/VASP family of proteins that in humans is encoded by the EVL gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 99 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINY SIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTF SNAMLFALNIMNSQEGGPSSQRQVQNGPSPDEMDIQRRQVMEQHQQQRQESLERRTSATGPILPPGHPSSAASAPVSC SGPPPPPPPPVPPPPTGATPPPPPPLPAGGAQGSSHDE SSMSGLAAAIAGAKLRRVQRPEDASGGSSPSGTSKSDANR ASSGGGGGG
Gene Name: EVL Enah/Vasp-like [ Homo sapiens ]
Official Symbol: EVL
Synonyms: EVL; Enah/Vasp-like; ena/VASP-like protein; RNB6;
Gene ID: 51466
mRNA Refseq: NM_016337
Protein Refseq: NP_057421
Uniprot ID: Q9UI08
Chromosome Location: 14q32.32
Pathway: Adaptive Immune System, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Generation of second messenger molecules, organism-specific biosystem; Immune System, organism-specific biosystem;
Function: SH3 domain binding; actin binding; profilin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.