Recombinant Human FKBP3, His-tagged FKBP3-28917TH

Recombinant Human FKBP3, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FKBP3, His-tagged

Recombinant Human FKBP3, His-tagged

FKBP3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FKBP3-28917TH
Product Overview : Recombinant fragment, corresponding to amino acids 49-224 of Human FKBP25 with an N-terminal His tag; Predicted MWt 21 kDa.
Description : The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 99 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNV KLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPK KGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSF KVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKG QPDAKIPPNAKLTFEVELVDID
Gene Name : FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ]
Official Symbol : FKBP3
Synonyms : FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase;
Gene ID : 2287
mRNA Refseq : NM_002013
Protein Refseq : NP_002004
MIM : 186947
Uniprot ID : Q00688
Chromosome Location : 14q21.2
Pathway : Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function : FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy