Recombinant Human FKBP3, His-tagged

• Cat.No.: FKBP3-28917TH
• Product Overview: Recombinant fragment, corresponding to amino acids 49-224 of Human FKBP25 with an N-terminal His tag; Predicted MWt 21 kDa.

Specification

• Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 99 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNV KLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPK KGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSF KVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKG QPDAKIPPNAKLTFEVELVDID

Gene Information

• Gene Name: FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ]
• Official Symbol: FKBP3
• Synonyms: FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase
• Gene ID: 2287
• mRNA Refseq: NM_002013
• Protein Refseq: NP_002004
• MIM: 186947
• Uniprot ID: Q00688
• Chromosome Location: 14q21.2
• Pathway: Signaling events mediated by HDAC Class I, organism-specific biosystem
• Function: FK506 binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; receptor activity