Recombinant Human FKBP3 Protein, His-tagged

• Cat.No.: FKBP3-795H
• Product Overview: Recombinant Human FKBP3 fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM TrisHCl, 1mM DTT, 10%glycerol, pH8.0
• Molecular Mass: 27.3kD
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ]
• Official Symbol: FKBP3
• Synonyms: FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase; rotamase; 25 kDa FKBP; PPIase FKBP3; immunophilin FKBP25; rapamycin binding protein; 25 kDa FK506-binding protein; FK506-binding protein 3 (25kD); FK506-binding protein 25, T-cell; rapamycin-selective 25 kDa immunophilin; FKBP-3; FKBP25; FKBP-25
• Gene ID: 2287
• mRNA Refseq: NM_002013
• Protein Refseq: NP_002004
• MIM: 186947
• UniProt ID: Q00688