Recombinant Human FKBP3 Protein, His-tagged
| Cat.No. : | FKBP3-795H |
| Product Overview : | Recombinant Human FKBP3 fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins. |
| Form : | Lyophilized from a 0.2 µM filtered solution of 20mM TrisHCl, 1mM DTT, 10%glycerol, pH8.0 |
| Molecular Mass : | 27.3kD |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ] |
| Official Symbol | FKBP3 |
| Synonyms | FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase; rotamase; 25 kDa FKBP; PPIase FKBP3; immunophilin FKBP25; rapamycin binding protein; 25 kDa FK506-binding protein; FK506-binding protein 3 (25kD); FK506-binding protein 25, T-cell; rapamycin-selective 25 kDa immunophilin; FKBP-3; FKBP25; FKBP-25; |
| Gene ID | 2287 |
| mRNA Refseq | NM_002013 |
| Protein Refseq | NP_002004 |
| MIM | 186947 |
| UniProt ID | Q00688 |
| ◆ Recombinant Proteins | ||
| FKBP3-3024H | Recombinant Human FKBP3 Protein (Met1-Asp224), N-His tagged | +Inquiry |
| FKBP3-9658H | Recombinant Human FKBP3 protein, His-tagged | +Inquiry |
| FKBP3-4804HF | Recombinant Full Length Human FKBP3 Protein, GST-tagged | +Inquiry |
| FKBP3-2921H | Recombinant Human FKBP3 protein, His-SUMO-tagged | +Inquiry |
| FKBP3-28917TH | Recombinant Human FKBP3, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FKBP3-6206HCL | Recombinant Human FKBP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP3 Products
Required fields are marked with *
My Review for All FKBP3 Products
Required fields are marked with *
