"FOXG1" Related Products

Recombinant Human FOXG1

Cat.No.: FOXG1-28945TH
Product Overview: Recombinant fragment of Human FOXG1 with N terminal proprietary tag, 32.24kDa.
Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon.
Protein length: 61 amino acids
Molecular Weight: 32.240kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expression is restricted to the neurons of the developing telencephalon.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGE
Sequence Similarities: Contains 1 fork-head DNA-binding domain.
Gene Name: FOXG1 forkhead box G1 [ Homo sapiens ]
Official Symbol: FOXG1
Synonyms: FOXG1; forkhead box G1; FKH2, FKHL1, FKHL2, FKHL3, FKHL4, forkhead box G1A , forkhead box G1B , forkhead box G1C , FOXG1A, FOXG1B, FOXG1C; forkhead box protein G1; BF1; HBF 3; HFK1; HFK2; HFK3; QIN;
Gene ID: 2290
mRNA Refseq: NM_005249
Protein Refseq: NP_005240
MIM: 164874
Uniprot ID: P55316
Chromosome Location: 14q11-q13
Pathway: Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem;
Function: DNA bending activity; DNA binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.